Spooky toxin (SsTx) is a small peptide neurotoxin.

FFKCTCYFTTG, disulfide bonds Cys43-Cys69, Cys47-Cys71), with a molecular weight of 6017.5 daltons, but loses the first 23 residues and becomes 53 residues long (sequence EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPFGFKCTCYFTTG, disulfide bonds Cys20-Cys46, Cys24-Cys48).

By blocking KCNQ channels (preventing potassium from flowing into and out of cells) SsTx disrupts cardiovascular, respiratory, muscular, and nervous systems; where snake venoms typically only affect circulatory or nervous systems, and venom from spiders, scorpions, and snails typically only target nervous systems.

This allows for golden headed centipedes to target larger prey up to 15 times their size.

[1] The venom of the Scolopendra subspinipes mutilans is already being widely used as a traditional medicine in Asian countries.